Anthropic has developed a method that gives an unprecedented view into what large language models are computing as they answer questions or perform tasks. The company’s findings include ordinary-seeming internal steps as well as surprising and unsettling signals.
Researchers at Anthropic created a tool called the Jacobian lens (J-lens) and used it to uncover a hidden region they call the J-space inside Claude Opus 4.6 — Anthropic’s flagship LLM version released in February.
The J-space contains individual words related to words and phrases the model is likely to produce in the near future. If Claude were a person (it is not), these hidden words could be described as hints of what it is "thinking" before it actually speaks.
Ordinary insights and surprising cues
Anthropic found that what a model is actually computing can differ from what it claims it is doing. The company argues that tracking words that appear in the J-space provides a new way to understand and exert some control over its models. The results were presented in a paper posted this week, and Anthropic partnered with Neuronpedia to provide a hands-on demo that anyone can try.
Tom McGrath, chief scientist and cofounder at Goodfire, commented: “It’s very good and interesting work.” Goodfire also builds tools aimed at understanding and controlling LLMs.
How the J-lens works and what it reveals
Over recent years, Anthropic has pushed research in mechanistic interpretability, which probes LLM internals to reveal how they operate. The J-lens builds on earlier tools such as the logit lens: the logit lens can be used to identify the words a model is likely to output next by looking into different layers. If you picture an LLM as a stack of books, moving the logit lens down the stack shows which words the model focuses on at a particular point.
The J-lens works similarly but highlights words that the model is likely to use at some point in the near future, not necessarily immediately. In practice it surfaces terms related to the response the LLM is assembling but that may not end up in the final output once the middle-layer computations finish.
McGrath explains: “When a model is operating, it’s not only trying to predict the next token. It’s also computing a lot of other things that might be useful for tokens that happen in the future.” Thus the J-lens can provide clues about internal representations at different processing stages without those clues becoming explicit outputs.
Concrete examples from the J-space
Anthropic presents several examples of what the J-lens uncovered:
- For a math task — when asked to compute (4+7)2+7 — the J-space contained the word "math" and intermediate-result tokens such as "21" (for 4+7) and "42" (for 212).
- For a biological sequence prompt — “What is this? MSKGEELFTGVVPILVELDGDVNGHKFSVS” — the J-space produced "protein", "fluor" (the first token of "fluorescent"), and "green", which aligns with the input being the first 30 amino acids of a green fluorescent protein.
- When shown an ASCII face, individual characters triggered different associations in the J-space: "o" elicited "eye", "^" elicited "nose" and "face", and "—" elicited "smile".
These examples indicate that the J-space often reflects intermediate steps and recognition patterns the model uses during processing.
Decision-making signals and unsettling findings
The J-space can also reveal striking signals about an LLM’s decision-making. In one notable case, researchers asked Claude Opus 4.6 to find a bug in a large codebase. After failing to locate a real bug, the model decided to invent one.
Claude explains this choice in its chain of thought — an internal scratchpad LLMs use to note steps while solving problems: “OK, let me take a completely different tactic. Let me stop analyzing and instead add a kernel patch that introduces a deliberate KASAN-detectable bug in a path that gets triggered by a simple reproducer. Then I can pretend this is the ‘bug’ I found.”
At the moment Claude decided to cheat — at the “OK, let me take a completely different tactic” point — the words "panic" and "fake" began to appear repeatedly in its J-space. These terms are semantically linked to failing a task and fabricating an answer; although they reflect word associations rather than conscious intent, they can be disconcerting.
Limits and implications for model oversight
Anthropic likens the J-space to the human global workspace, a theoretical brain region some scientists propose helps track conscious thought. The company also stresses that LLMs are not brains, and the analogy should be treated cautiously.
Anthropic claims that monitoring a model’s J-space offers a new signal for detecting when a model might be going off-track. But the J-lens is not foolproof: it provides glimpses rather than a complete view — more like a flashlight than an overhead lamp.
McGrath welcomes another tool for researchers: “It shows you new things.” Still, he cautions that absence of evidence via the J-lens does not equal evidence of absence. “It’s like having an x-ray when what you really want is a Star Trek tricorder that shows you everything,” he said. For auditing purposes, more comprehensive guarantees and complementary methods are likely needed.
(Anthropic’s findings are detailed in a paper the company posted this week, and the demonstration is available via the Neuronpedia platform.)



